PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G10270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 317aa    MW: 34808.9 Da    PI: 9.621
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G10270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.52e-32163219158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep++VNaKQy++Il+RRq+Rakle+++k   k+rkpylheSRh+hA++R+RgsgGrF
  ONIVA03G10270.1 163 EEPIFVNAKQYNAILRRRQTRAKLEAQNKA-VKGRKPYLHESRHRHAMKRARGSGGRF 219
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-35161222IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.46162222IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.1E-28164219IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-23165187IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860167187IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.1E-23196219IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MIMLLQEMEN HPVQCMAKTN YDFLARNNYP MKQLVQRNSD GDSSPTKSGQ SHQEASAVSD  60
SSLNGQHTSP QSVFVPSDIN NNDSCGERDH GTKSVLSLGN TEAAFPPSKF DYNQPFACVS  120
YPYGTDPYYG GVLTGYTSHA FVHPQITGAA NSRMPLPVDP SVEEPIFVNA KQYNAILRRR  180
QTRAKLEAQN KAVKGRKPYL HESRHRHAMK RARGSGGRFL TKKELLEQQQ QQQQQKPPPA  240
SAQSPTGRAR MSGGAVVLGK NLCPENSTSC SPSTPTGSEI SSISFGGGML AHQEHISFAS  300
ADRHPTMNQN HRVPVMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-22162224163NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203212RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0621350.0AK062135.1 Oryza sativa Japonica Group cDNA clone:001-045-F05, full insert sequence.
GenBankEU8470110.0EU847011.1 Oryza sativa Japonica Group clone KCS132A05 CCAAT-binding transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631980.10.0PREDICTED: nuclear transcription factor Y subunit A-4
TrEMBLA0A0E0GJE20.0A0A0E0GJE2_ORYNI; Uncharacterized protein
STRINGLOC_Os03g29760.10.0(Oryza sativa Japonica Group)
STRINGORGLA03G0197400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.18e-37nuclear factor Y, subunit A6